>AF157960 Pachyptila desolata 
AAGAAGGGCAAAGGCAAACCCAGCGGAGGCGGCTGGGGCACGGGGAGCCACCGCCAGCCCAGCTACCCCC
GCCAGCCCGGCTACCCCCAAAATCCCGGCTATCCCCATAATCCGGGCTACCCCCACAACCCGGGGTACCC
CCACAACCCGGGGTACCCCCACAACCCGGGGTACCCGCAGAACCCTGGATGGGGACAGGGTTACAACCCA
TCCAGCGGAGGAACCTACCACAACCAAAAGCCATGGAAACCCCCCAAATCTAAGACCAACTTCAAGCACG
TGGCCGGGGCGGCGGCGGCGGGCGCCGTGGTGGGAGGTTTGGGGGGCTACGCCATAGGACGCGTCATGTC
GGGGATGCACTATCGCTTCGACAGCCCCGACGAGTACCGATGGTGGAACGAAAATTCGGCGCGTTACCCC
AACCAGGTTTACTACCCGGATTACCGCAGCCCCGTCTCGCAGGACGTCTTCGTCGCCGACTGCTTTAACA
TCACGGTGACCGAATACAACATCGGACCCGCCGCCAAGAAGAACGTGTCGGAGGCCGCTCCGGCCGCCAA
CCAAACGGAGACGGAGCTGGAGACCAAGGTGGTGACGAAGGTGATCCGGGAGATGTGCATCCAGCAGTAC
CGCGAGTACCGCCTG

>AF157959 Pachyptila turtur
AAGAAGGGCAAAGGCAAACCCAGCGGAGGCGGCTGGGGCACGGGGAGCCATCGCCAGCCCAGCTACCCCC
GCCAGCCCGGCTACCCCCAAAATCCCGGCTATCCCCATAATCCGGGCTACCCCCACAACCCGGGGTACCC
CCACAACCCGGGGTACCCCCACAACCCGGGGTACCCCCAGAACCCTGGATGGGGACAGGGTTACAACCCA
TCCAGCGGAGGAACCTACCACAACCAAAAGCCATGGAAACCCCCCAAATCTAAGACCAACTTCAAGCACG
TGGCCGGGGCGGCGGCGGCGGGCGCCGTGGTGGGAGGTTTGGGGGGCTACGCCATGGGACGCGTCATGTC
GGGGATGCACTATCGCTTCGACAGCCCCGACGAGTACCGATGGTGGAACGAAAATTCGGCGCGTTACCCC
AACCAGGTTTACTACCGGGATTACCGCAGCCCCGTCTCGCAGGATGTCTTCGTCGCCGACTGCTTTAACA
TCACGGTGACCGAATACAACATCGGACCCGCCGCCAAGAAGAACGTGTCGGAGGCCGCTCCGGCCGCCAA
CCAAACGGAGACGGAGCTGGAGACCAAGGTGGTGACGAAGGTGATCCGGGAGATGTGCATCCAGCAGTAC
CGCGAGTACCGCCTG

>AF157958 Tyto alba
AAGAAAGGCAAAGGCAAACCCAGCGGAGGCGGCTGGGGCACGGGGAGCCATCGCCAGCCCAGCTACCCCC
GCCAGCCCGGCTACCCCCAAAACCCCAGCTATCCTCATAACCCGGGGTACCCCCACAACCCGGGGTACCC
CCACAACCCGGGGTACCCCCACAACCCGGGGTACCCCCACAACCCGGGGTGGGGCCAGGGTTACAACCCA
TCCAGCGGAGGAAGCTACCACAACCAAAAACCGTGGAAACCCCCCAAATCCAAGACCAACTTCAAGCACG
TGGCCGGGGCAGCAGCGGCGGGCGCCGTGGTGGGAGGTTTGGGGGGCTACGCCATGGGACGTGTCATGTC
GGGGATGCACTACCGCTTCGACAGCCCCGATGAGTACCAGTGGTGGAATGAAAATTCAGCCCGTTATCCC
AACCGCGTTTACTACCGGGATTACAGCAGCCCCGTCACGCAGGACGTCTTCGTCGCCGACTGCTTTAACA
TCACGGTGACCGAATACAACATCGGACCCGCCGCCAAGAAGAACACCTCGGAGGCTGGGCCGGCAGTCAA
CCAAACAGAGATGGAGATGGAGACCAAGGTGGTGACGAAGGTGATCCGGGAGATGTGCGTCCAGCAGTAC
CGCGAGTACCGCCTG

>AF157957 Struthio camelus
CCCCATAATCCCGGCTACCCCCACAACCCAGGCTATCCCCATAATCCCGGCTACCCCCACAACCCAGGCT
ACCCCCACAACCCAGGCTGGGGACAAGGCTACAACCCATCCAGCGGAGGAAGCTACCACAACCAAAAGCC
TTGGAAACCCCCAAAATCCAAGACCAACTTCAAGCACGTGGCCGGGGCCGCGGCGGCTGGCGCCGTGGTG
GGTGGCTTGGGGGGCTACGTCATGGGCCGCGCCATGTCGGGGATGCACTACCATTTCGACAGCCCCGACG
AGTACCGGTGGTGGAACGAGAATGCGGGACGCTACCCCAACCGGGTGTACTACCGGGACTACAGCAGCCC
CGTGACGCAGGACATG

>AF157956 Anas platyrhynchos
AAGAAGGGTAAAGGCAAACCCAGTGGGGGTGGCTGGGGCACTGGGAGTCACCGCCAGCCCAGCTACCCCC
GCCAGCCTGGCTACCCCCAGAATCCTGGTTATCCCCACAACCCGGGGTATCCCCACAACCCGGGGTACCC
CCATAACCCAGGGTACCCCCACAACCCCGGCTGGGGATACAACCCATCCAGCGGAGGAAACTATCACCAC
CAAAAGCCATGGAAACCCCCGAAGACCAACTTCAAGCATGTGGCTGGGGCAGCAGCAGCGGGTGCCGTGG
TGGGGGGCTTGGGGGGCTACGCCATGGGGCGCGTCATGTCAGGGATGCACTACCACTTCGACAGCCCAGA
CGAGTACAGGTGGTGGAACGAGAACTCAGCGCGTTATCCCAACCGGGTTTACTACCGGGATTACGGCAGC
ACTGTGTCACAGGACGTGTTCGTTGCTGACTGTTTCAACATCACAGTGACTGAGTACAACATTGGCCCCG
CTGCCAAGAAGAACGGCTCGGAGGCTGGCCCAGGGGCAAACCAAACGGAGACGGAGATGGAGACCAAGGT
GGTGACAAAAGTGATCCGTGAGATGTGTGTGCAGCAGTACCGCGAGTACCGCCTG

>AF157955 Balearica pavonina gibbericeps
AAGAAGGGCAAAGGCAAACCCAGCGGAGGCGGTTGGGGCACTGGGAGCCACCGCCAGCCCAGCTACCCCC
GCCAGCCCGGCTACCCCCAAAATCCCGGCTACCCCCATAATCCGGGGTACCCCCACAACCCTGGCTATCC
CCACAACCCTGGCTATCCCCACAACCCGGGGTGGGGACAGGGTTACAACCCATCCAGTGGAGGAAGCTAC
CACAACCAAAAGCCGTGGAAACCCCCCAAATCCAAGACCAACTTGAAGCACGTGGCCGGGGCGGCAGCAG
CGGGTGCCGTGGTGGGAGGTTTGGGGGGTTACGCCATGGGACGCGTCATGTCGGGGATGCACTATCGCTT
CGACAGCCCCGACGAGTACCGCTGGTGGAACGAAAATTCGGCGCGTTACCCCAACCAGGTTTACTACCGG
GATTACAGCAGCCCCGTCTCGCAGGACGTCTTCGTCGCCGACTGCTTTAACATCACGGTGACCGAATACA
ACATCGGGCCCGCCGCCAAGAAGAACGTGTCTGAGGCCGGTGCGGCGGTCAACCAGACGGAGACAGAGCT
GGAGACCAAGGTGGTGACGAAGGTGATCCGGGAGATGTGCATCCAGCAGTACCGCGAGTACCGCCTG

>AF157954 Vultur gryphus
AAGAAGGGCAAAGGCAAACCCAGCGGAGGGGGCTGGGGCACGGGGAGCCACCGCCAGCCCAGCTACCCCC
GCCAGCCTAGCTACCCCCAAAATCCCGGCTATCCCCATAATCCAGGCTACCCCCACAACCCGGGGTATCC
CCACAACCCGGGGTACCCCCACAACCCAGGGTGGGGACAGGGTTACAACCCATCCAGCGGAGGAAGCTAC
CACAACCAAAAGCCATGGAAACCCCCCAAATCCAAGACCAACTTCAAGCACGTGGCCGGGGCGGCGGCGG
CGGGTGCCGTGGTGGGAGGTTTGGGGGGCTACGCCATGGGACGCGTCATGTCGGGGATGCACTATCGCTT
CGACAGCCCTGATGAGTACCGATGGTGGAATGAAAATTCGGCGCGTTACCCCAACCAGGTTTACTACCGG
GATTACAGCAGCCCCGTCTCGCAGGACATCTTCGTCGCCGACTGCTTTAACATCACGGTGACCGAATACA
ACATCGGACCCGCCGCCAAGAAGAACACCTCGGAGGCTGGTCTGGCGGTGAACCAAACGGAGACGGAGCT
GGAGACCAAGGTGGTGACGAAGGTGATCCGGGAGATGTGCATCCAGCAGTACCGCGAGTACCGCCTG

>M95404 Gallus gallus (flanking sequence lower case)
actgccctaacagtgtgtgtccttatgcccgcagccATGGCTAGGCTCCTCACCACCTGCTGCCTGCTGG
CCCTGCTGCTCGCCGCCTGCACCGACGTCGCCCTCTCCAAGAAGGGCAAAGGCAAACCCAGTGGTGGGGG
TTGGGGCGCCGGGAGCCATCGCCAGCCCAGCTACCCCCGCCAGCCGGGCTACCCTCATAACCCAGGGTAC
CCCCATAACCCAGGGTACCCCCATAACCCAGGGTACCCCCACAACCCTGGCTATCCCCATAACCCCGGCT
ACCCCCAGAACCCTGGCTACCCCCATAACCCAGGTTACCCAGGCTGGGGTCAAGGCTACAACCCATCCAG
CGGAGGAAGTTACCACAACCAGAAGCCATGGAAACCCCCCAAAACCAACTTCAAGCACGTGGCGGGGGCA
GCAGCGGCGGGTGCTGTGGTGGGGGGCTTGGGGGGCTACGCCATGGGGCGCGTTATGTCAGGGATGAACT
ACCACTTCGATAGCCCCGATGAGTACCGATGGTGGAGTGAGAACTCGGCGCGTTATCCCAACCGGGTTTA
CTACCGGGATTACAGCAGCCCCGTGCCACAGGACGTCTTCGTGGCCGATTGCTTTAACATCACAGTGACT
GAGTACAGCATTGGCCCTGCTGCCAAGAAGAACACCTCCGAGGCTGTGGCGGCAGCAAACCAAACGGAGG
TGGAGATGGAGAACAAAGTGGTGACGAAGGTGATCCGCGAGATGTGCGTGCAGCAGTACCGCGAGTACCG
CCTGGCCTCGGGCATCCAGCTGCACCCTGCTGACACCTGGCTCGCCGTCCTCCTCCTCCTCCTCACCACC
CTTTTTGCCATGCACTGAtgggatgccgtgccccggccctgtggcagtgagatgacatcgtgtccccgtg
cccacccatggggtgttccttgtcctcgcttttgtccatctttggtgaagatgtccccc

>M61145 Gallus gallus allele (flanking sequence lower case)
gaattccctcggcagccagctcctccctctcgctatttattcctttctcccccccctacgctggatctgg
atcatctcaagccgagcggtgacggcttcttggatcgctcatacataaatatctgtgagtcagaggaagc
aaccaccgaccccaagacctcaccccgagccATGGCTAGGCTCCTCACCACCTGCTGCCTGCTGGCCCTG
CTGCTCGCCGCCTGCACCGACGTCGCCCTCTCCAAGAAGGGCAAAGGCAAACCCAGTGGTGGGGGTTGGG
GCGCCGGGAGCCATCGCCAGCCCAGCTACCCCCGCCAGCCGGGCTACCCTCATAACCCAGGGTACCCCCA
TAACCCAGGGTACCCCCACAACCCTGGCTATCCCCATAACCCCGGCTACCCCCAGAACCCTGGCTACCCC
CATAACCCAGGTTACCCAGGCTGGGGTCAAGGCTACAACCCATCCAGCGGAGGAAGTTACCACAACCAGA
AGCCATGGAAACCCCCCAAAACCAACTTCAAGCACGTGGCGGGGGCAGCAGCGGCGGGTGCTGTGGTGGG
GGGCTTGGGGGGCTACGCCATGGGGCGCGTTATGTCAGGGATGAACTACCACTTCGATAGACCCGATGAG
TACCGATGGTGGAGTGAGAACTCGGCGCGTTATCCCAACCGGGTTTACTACCGGGATTACAGCAGCCCCG
TGCCACAGGACGTCTTCGTGGCCGATTGCTTTAACATCACAGTGACTGAGTACAGCATTGGCCCTGCTGC
CAAGAAGAACACCTCCGAGGCTGTGGCGGCAGCAAACCAAACGGAGGTGGAGATGGAGAACAAAGTGGTG
ACGAAGGTGATCCGCGAGATGTGCGTGCAGCAGTACCGCGAGTACCGCCTGGCCTCGGGCATCCAGCTGC
ACCCTGCTGACACCTGGCTCGCCGTCCTCCTCCTCCTCCTCACCACCCTTTTTGCCATGCACTGAtggga
tgccgtgccccggccctgtggcagtgagatgacatcgtgtccccgtgcccacccatggggtgttccttgt
cctcgcttttgtccatctttggtgaagatgtccccccgctgcctccccgcaggctctgatttgggcaaat
gggaggggattttgtcctgtcctggtcgtggcaggacggctgctggtggtggagtgggatgcccaaaaaa
tggccttcaccacttcctcctcctcttcctttctggggcggagatatgggctcgtccagcccttattgtc
cctgcaagagcgtatctgaaaatcctctttgctaacaagcagggttttacctaatctgcttagccccagt
gacagcagagcgcctttccccagggcacaccaaccccaagctgaggtgcttggcagccacacgtcccatg
gaggctgatgggttttggggcgtcccaagcaacaccctgggctactgaggtgcaattgtagctctttaat
ctgccaatcccaaccctaccgtgtagataggaactgcctgctctgcattttgcatgctgcaaacacctcc
tgccgcagcgcccccaaaatagagtgatttgggaatagtgaggctgaagccacagcagcttgggattggg
ctcatcatatcaatccatgatgctttgcttccagctgagcctcactgcccttttatagcctgcccagagg
aagggagcgctgctaaatgcccaaaaaggtaacactgagcaaaagcttatttcaatgtatgatagagaac
gagtgcatctcgcacagatcagccatgggagcatcgtttgccatcagccccaaaacccaaaggatgctaa
aatgcagccaaaggggaatcaagcacgcagggaaggacttgaatcagctcaactggattgaaatggcaaa
aggcatgagtagaacgaacggcaaggggatgctggagatccacctcctgtgagcaaattgttcgatgcag
ccaatggaactattgcttcttgtgcttcagttgctgctgatgtgtacataggctgtagcatatgtaaagt
tacacgtgtcaagctgctcgcaccgcgtagagctaatatgtatcatgtatgtgggcactgaatgccaccg
ttggccatacccaaccgtcctaaacgattttcacgtcgctgtaacttaagtggagatacactttcagtat
attcagcaaaaggaattc

>AAD47051 Pachyptila desolata
KKGKGKPSGGGWGTGSHRQPSYPRQPGYPQNPGYPHNPGYPHNPGYPHNPGYPHNPGYPQNPGWGQGYNP
SSGGTYHNQKPWKPPKSKTNFKHVAGAAAAGAVVGGLGGYAIGRVMSGMHYRFDSPDEYRWWNENSARYP
NQVYYPDYRSPVSQDVFVADCFNITVTEYNIGPAAKKNVSEAAPAANQTETELETKVVTKVIREMCIQQY
REYRL

>AAD47050 Pachyptila turtur
KKGKGKPSGGGWGTGSHRQPSYPRQPGYPQNPGYPHNPGYPHNPGYPHNPGYPHNPGYPQNPGWGQGYNP
SSGGTYHNQKPWKPPKSKTNFKHVAGAAAAGAVVGGLGGYAMGRVMSGMHYRFDSPDEYRWWNENSARYP
NQVYYRDYRSPVSQDVFVADCFNITVTEYNIGPAAKKNVSEAAPAANQTETELETKVVTKVIREMCIQQY
REYRL

>AAD47049 Tyto alba 
KKGKGKPSGGGWGTGSHRQPSYPRQPGYPQNPSYPHNPGYPHNPGYPHNPGYPHNPGYPHNPGWGQGYNP
SSGGSYHNQKPWKPPKSKTNFKHVAGAAAAGAVVGGLGGYAMGRVMSGMHYRFDSPDEYQWWNENSARYP
NRVYYRDYSSPVTQDVFVADCFNITVTEYNIGPAAKKNTSEAGPAVNQTEMEMETKVVTKVIREMCVQQY
REYRL

>AAD47048 Struthio camelus
PHNPGYPHNPGYPHNPGYPHNPGYPHNPGWGQGYNPSSGGSYHNQKPWKPPKSKTNFKHVAGAAAAGAVV
GGLGGYVMGRAMSGMHYHFDSPDEYRWWNENAGRYPNRVYYRDYSSPVTQDM

>AAD47047 Anas platyrhynchos 
KKGKGKPSGGGWGTGSHRQPSYPRQPGYPQNPGYPHNPGYPHNPGYPHNPGYPHNPGWGYNPSSGGNYHH
QKPWKPPKTNFKHVAGAAAAGAVVGGLGGYAMGRVMSGMHYHFDSPDEYRWWNENSARYPNRVYYRDYGS
TVSQDVFVADCFNITVTEYNIGPAAKKNGSEAGPGANQTETEMETKVVTKVIREMCVQQYREYRL

>AAD47046 Balearica pavonina gibbericeps 
KKGKGKPSGGGWGTGSHRQPSYPRQPGYPQNPGYPHNPGYPHNPGYPHNPGYPHNPGWGQGYNPSSGGSY
HNQKPWKPPKSKTNLKHVAGAAAAGAVVGGLGGYAMGRVMSGMHYRFDSPDEYRWWNENSARYPNQVYYR
DYSSPVSQDVFVADCFNITVTEYNIGPAAKKNVSEAGAAVNQTETELETKVVTKVIREMCIQQYREYRL

>AAD47045 Vultur gryphus
KKGKGKPSGGGWGTGSHRQPSYPRQPSYPQNPGYPHNPGYPHNPGYPHNPGYPHNPGWGQGYNPSSGGSY
HNQKPWKPPKSKTNFKHVAGAAAAGAVVGGLGGYAMGRVMSGMHYRFDSPDEYRWWNENSARYPNQVYYR
DYSSPVSQDIFVADCFNITVTEYNIGPAAKKNTSEAGLAVNQTETELETKVVTKVIREMCIQQYREYRL

>AAA49041 Gallus gallus
MARLLTTCCLLALLLAACTDVALSKKGKGKPSGGGWGAGSHRQPSYPRQPGYPHNPGYPHNPGYPHNPGY
PHNPGYPQNPGYPHNPGYPGWGQGYNPSSGGSYHNQKPWKPPKTNFKHVAGAAAAGAVVGGLGGYAMGRV
MSGMNYHFDRPDEYRWWSENSARYPNRVYYRDYSSPVPQDVFVADCFNITVTEYSIGPAAKKNTSEAVAA
ANQTEVEMENKVVTKVIREMCVQQYREYRLASGIQLHPADTWLAVLLLLLTTLFAMH

>AAC28970 Gallus gallus
MARLLTTCCLLALLLAACTDVALSKKGKGKPSGGGWGAGSHRQPSYPRQPGYPHNPGYPHNPGYPHNPGY
PHNPGYPHNPGYPQNPGYPHNPGYPGWGQGYNPSSGGSYHNQKPWKPPKTNFKHVAGAAAAGAVVGGLGG
YAMGRVMSGMNYHFDSPDEYRWWSENSARYPNRVYYRDYSSPVPQDVFVADCFNITVTEYSIGPAAKKNT
SEAVAAANQTEVEMENKVVTKVIREMCVQQYREYRLASGIQLHPADTWLAVLLLLLTTLFAMH
>L38993 Trichosurus vulpecular (flanking sequence lower case)
aagcttcagctggctggctggtgtccaaagaaggttaagtgtcgcttctaaagggtttctcccaaaagaa
catcaaagaaagtttacacttcatattgcattcaaggctgccaatctttgctgttttttaatagaagcat
cctactccttcctgatatcatattatgacaattaaaaatgacatatatgtgtcttaattgtgtttctttt
ttcccctccttttcctttagtggtttctaaataaacccagaattttcatgtctttttttttttccagatc
acctaccATGGGAAAAATCCAATTGGGATACTGGATCTTGGTTCTCTTCATTGTTACCTGGAGTGATCTA
GGCCTCTGTAAGAAACCAAAGCCAAGACCCGGAGGGGGGTGGAACAGCGGAGGAAGCAACCGCTACCCAG
GCCAGCCTGGTAGCCCTGGAGGCAACCGATACCCTGGCTGGGGGCACCCTCAGGGAGGTGGCACCAATTG
GGGTCAGCCCCATCCCGGGGGTTCCAATTGGGGTCAGCCCCATCCTGGGGGTTCCAGTTGGGGTCAGCCA
CATGGTGGATCTAACTGGGGTCAGGGCGGCTACAACAAGTGGAAACCAGATAAACCCAAAACCAACCTAA
AACATGTGGCTGGAGCCGCTGCTGCTGGGGCAGTTGTGGGAGGGCTTGGTGGCTACATGCTGGGGAGTGC
CATGAGCAGGCCCGTCATACACTTTGGCAATGAATACGAAGACCGCTACTATCGAGAAAACCAGTACCGC
TACCCCAACCAAGTCATGTACCGGCCCATCGACCAGTACAGCAGCCAGAACAATTTTGTGCATGACTGCG
TCAACATCACGGTGAAACAACACACCACCACCACCACCACCAAAGGGGAGAACTTCACAGAAACTGATAT
CAAGATTATGGAGCGTGTGGTGGAGCAGATGTGCATCACGCAGTACCAAGCTGAGTACGAGGCTGCCGCT
CAGCGCGCGTACAACATGGCATTCTTCTCTGCCCCGCCAGTGACCCTCCTCTTCCTCAGCTTCCTTATTT
TCCTGATTGTGAGCTAAgaagccttccgatgtttactctctcaatgtttattctcttaatctttgcagag
aaggaaatccttcagtctgcaagggcagcccaaatagcagcagtttttcatttctatgttcgtccatcac
ccataggttaaggcccttatcactcatgagccctgggaaatgtacagtagatcccagaggcccggccacc
gctctcctccaaaccattttgatcatgcgtctgtcagatcaatgccacctttggcagtatcctttctgag
ggagatcattgggtaacttctggtccatctaga

>AAA61833 Trichosurus vulpecular
MGKIQLGYWILVLFIVTWSDLGLCKKPKPRPGGGWNSGGSNRYPGQPGSPGGNRYPGWGHPQGGGTNWGQ
PHPGGSNWGQPHPGGSSWGQPHGGSNWGQGGYNKWKPDKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMS
RPVIHFGNEYEDRYYRENQYRYPNQVMYRPIDQYSSQNNFVHDCVNITVKQHTTTTTTKGENFTETDIKI
MERVVEQMCITQYQAEYEAAAQRAYNMAFFSAPPVTLLFLSFLIFLIVS