mouse doppel U29187 with mouse long = AF192385
MKNRLGTWWVAILCMLLASHLSTVKARGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKL
DIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRV
LWRLIKEICSAKHCDFWLERGAALRVAVDQPAMVCLLGFVWFIVK

atgaagaaccggctgggtacatggtgggtggccatcctctgcatgctgcttgccagccacctctcca
cggtcaaggcaaggggcataaagcacaggttcaagtggaaccggaaggtcctgcccagcagcggcgg
ccagatcaccgaagctcgggtagctgagaaccgcccaggagccttcatcaagcaaggccggaagctg
gacatcgactttggagcagagggcaacaggtactacgcggctaactattggcagttccctgatggga
tctactacgaaggctgctctgaagccaacgtgaccaaggagatgctggtgaccagctgcgtcaacgc
cacccaggcggccaaccaggctgagttctcccgggagaagcaggatagcaagctccaccagcgagtc
ctgtggcggctgatcaaagagatctgctccgccaagcactgcgatttctggctggaaaggggagctg
cgcttcgggtcgccgtggaccaaccggcgatggtctgcctgctgggtttcgtttggttcattgtgaagtaa


rat doppel protein available, no DNA released, no EST help, no htgs, no nrn
 
MKNRLGTWGLAILCLLLASHLSTVKARGIKHRFKWNRKVLPSSGQITEAQVAENRPGAFIKQGRKL
DIDFGAEGNKYYAANYWQFPDGIYYEGCSEANVTKEVLVTRCVNATQAANQAEFSREKQDSKLHQR
VLWRLIKEICSTKHCDFWLERGAALRITVDQQAMVCLLGFIWFIVK


human doppel AF106918 M174
MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKL
DIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVL
WRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLMVK

atgaggaagcacctgagctggtggtggctggccactgtctgcatgctgctcttcagccacctctct
gcggtccagacgaggggcatcaagcacagaatcaagtggaaccggaaggccctgcccagcactgcc
cagatcactgaggcccaggtggctgagaaccgcccgggagccttcatcaagcaaggccgcaagctc
gacattgacttcggagccgagggcaacaggtactacgaggccaactactggcagttccccgatggc
atccactacaacggctgctctgaggctaatgtgaccaaggaggcatttgtcaccggctgcatcaat
gccacccaggcggcgaaccagggggagttccagaagccagacaacaagctccaccagcaggtgctc
tggcggctggtccaggagctctgctccctcaagcattgcgagttttggttggagaggggcgcagga
cttcgggtcaccatgcaccagccagtgctcctctgccttctggctttgatctggctcatggtgaaataa


human doppel AL133396 allele T174  53553-53026 needed RC. single t to c change.
MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKL
DIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVL
WRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK

atgaggaagcacctgagctggtggtggctggccactgtctgcatgctgctcttcagccacctctct
gcggtccagacgaggggcatcaagcacagaatcaagtggaaccggaaggccctgcccagcactgcc
cagatcactgaggcccaggtggctgagaaccgcccgggagccttcatcaagcaaggccgcaagctc
gacattgacttcggagccgagggcaacaggtactacgaggccaactactggcagttccccgatggc
atccactacaacggctgctctgaggctaatgtgaccaaggaggcatttgtcaccggctgcatcaat
gccacccaggcggcgaaccagggggagttccagaagccagacaacaagctccaccagcaggtgctc
tggcggctggtccaggagctctgctccctcaagcattgcgagttttggttggagaggggcgcagga
cttcgggtcaccatgcaccagccagtgctcctctgccttctggctttgatctggctcacggtgaaataa