Prions
Mad Cow Home or Best Links

CLUSTAL W (1.7) multiple sequence alignment of 4 mule deer sequences

 
AF009180        -----------------------CKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGW
AF009181        -----------------------CKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGW
U25965          MVKSHIGSWILVLFVAMWSDVGLCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGW
U97331          -----------------------CKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGW
                                       *************************************

AF009180        GQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAA
AF009181        GQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAA
U25965          GQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAA
U97331          GQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAA
                ************************************************************

AF009180        AGAVVGGLGGYMLGSAMSSPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVH
AF009181        AGAVVGGLGGYMLGSAMSSPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVH
U25965          AGAVVGGLGGYMLGSAMNRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVH
U97331          AGAVVGGLGGYMLGSAMNRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVH
                *****************. *****************************************

AF009180        DCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASVILFSS
AF009181        DCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASVILFSS
U25965          DCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASVILFSS
U97331          DCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASVILFSS
                ************************************************************

AF009180        PPV-------------
AF009181        PPV-------------
U25965          PPVILLISFLIFLIVG
U97331          PPV-------------
                ***             
Mad Cow Home or Best Links